SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9S339 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9S339
Domain Number 1 Region: 147-376
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-59
Family Nuclear receptor ligand-binding domain 0.000000000858
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9S339
Sequence length 490
Comment (tr|A0A0D9S339|A0A0D9S339_CHLSB) Thyroid hormone receptor, alpha {ECO:0000313|Ensembl:ENSCSAP00000015278} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=THRA OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSDEEPEVC
EDLAGNAASP
Download sequence
Identical sequences A0A096P5F1 A0A0D9S339 A0A2K5KQN4 A0A2K5V0G8 I0FFV5
ENSMMUP00000003920 XP_001088232.2.72884 ENSMMUP00000003920 9544.ENSMMUP00000003920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]