SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9S639 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9S639
Domain Number 1 Region: 397-497
Classification Level Classification E-value
Superfamily E set domains 2.27e-26
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000165
Family B-box zinc-binding domain 0.0034
Further Details:      
 
Domain Number 3 Region: 26-59,94-102
Classification Level Classification E-value
Superfamily RING/U-box 0.000000402
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  A0A0D9S639
Domain Number - Region: 225-328
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00549
Family Apolipoprotein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9S639
Sequence length 580
Comment (tr|A0A0D9S639|A0A0D9S639_CHLSB) Tripartite motif containing 45 {ECO:0000313|Ensembl:ENSCSAP00000016328} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=TRIM45 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MSENRKPLLGIVSKLPNGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVND
VMLESLRGEGQGLVCDLCNDREVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLK
GYSRIGKPILCPIHPAEELRLFCEFCDRPVCRDCVVGEHREHPCDFTSNVIHKHGDSVRE
LLKGTQPHVEALEEALAQINIMNSALQKRVEAVAADVQTFSEGYIKAIEEHRDKLLKQLE
DIRIQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKGVVVERLRKLNKV
QYSARPGVNDKIRFCPQEKAGQCHGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF
TLLCKDAAGEIMGRGGDNIQVAVLPKDKKDSPVRPMVQDNKDGTYYISYTPKEPGVYTVW
VCVKEQHVQGSPFTVTVRRKHRPHPGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHG
HKGHPGRPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences A0A0D9S639 A0A2K6CHA8 G7MFZ7 G7NX54
ENSMMUP00000039315 ENSMMUP00000021014 9544.ENSMMUP00000021014 NP_001253655.1.72884 XP_005542250.1.63531 XP_007975607.1.81039 XP_011735221.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]