SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9S6Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9S6Z1
Domain Number 1 Region: 216-278
Classification Level Classification E-value
Superfamily Homeodomain-like 1.96e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000157
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 67-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000101
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9S6Z1
Sequence length 352
Comment (tr|A0A0D9S6Z1|A0A0D9S6Z1_CHLSB) LIM homeobox 8 {ECO:0000313|Ensembl:ENSCSAP00000016630} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=LHX8 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
QQCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMAS
GSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFC
KLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKV
LCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVMQAQF
AQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPSRLSP
PMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPISHT
Download sequence
Identical sequences A0A0D9S6Z1
ENSPANP00000001717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]