SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9S8C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9S8C5
Domain Number 1 Region: 301-347
Classification Level Classification E-value
Superfamily RING/U-box 0.000000202
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9S8C5
Sequence length 352
Comment (tr|A0A0D9S8C5|A0A0D9S8C5_CHLSB) Mitochondrial E3 ubiquitin protein ligase 1 {ECO:0000313|Ensembl:ENSCSAP00000017114} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=MUL1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPG
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
Download sequence
Identical sequences A0A024RAA0 A0A0D9S8C5 G3QUY4 H2PY85 Q969V5
ENSP00000264198 NP_078820.2.87134 NP_078820.2.92137 XP_003814451.1.60992 XP_007978400.1.81039 XP_018867592.1.27298 XP_513168.3.37143 9606.ENSP00000264198 ENSGGOP00000006545 ENSP00000264198 ENSP00000264198 gi|171542821|ref|NP_078820.2| HR5400 ENSGGOP00000006545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]