SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9SE85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9SE85
Domain Number 1 Region: 16-106
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-21
Family Ankyrin repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9SE85
Sequence length 114
Comment (tr|A0A0D9SE85|A0A0D9SE85_CHLSB) NOTCH regulated ankyrin repeat protein {ECO:0000313|Ensembl:ENSCSAP00000019174} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=NRARP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVI
DGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
Download sequence
Identical sequences A0A096MWJ7 A0A0D9SE85 A0A1A6GUE0 A0A1S3AQ48 A0A1U7R917 A0A2J8RMM0 A0A2K5HFW7 A0A2K5KSW5 A0A2K6AVL9 A0A2K6EG81 D3Z9S9 G3S8K2 G7NET5 H0XUJ2 H2R2I1 I3N7M7 Q7Z6K4 Q91ZA8
ENSPANP00000004253 ENSMUSP00000100615 ENSP00000349041 ENSRNOP00000058835 ENSGGOP00000024415 10090.ENSMUSP00000100615 10116.ENSRNOP00000058835 9598.ENSPTRP00000043986 9606.ENSP00000349041 NP_001004354.1.87134 NP_001004354.1.92137 NP_001137222.1.100692 NP_001137222.1.4139 NP_080256.2.92730 XP_001116892.2.72884 XP_003794847.1.62490 XP_004048992.1.27298 XP_004390721.1.4749 XP_004654190.1.11716 XP_005083774.1.91757 XP_005336933.1.77405 XP_005346400.1.66349 XP_006863718.1.41390 XP_007539047.1.11023 XP_008003673.1.81039 XP_008829420.1.79516 XP_011723200.1.29376 XP_011812622.1.43180 XP_012510228.1.63892 XP_012639910.1.48125 XP_015361179.1.40921 XP_015855018.1.50099 XP_017457306.1.4139 XP_021048757.1.100879 XP_021506752.1.76796 gi|51972284|ref|NP_001004354.1| ENSOGAP00000019784 ENSP00000349041 ENSSTOP00000020373 ENSMUSP00000100615 ENSSTOP00000020373 ENSGGOP00000024415 ENSMUSP00000100615 ENSPTRP00000043986 ENSP00000349041 ENSOGAP00000019784 ENSRNOP00000058835 ENSPTRP00000043986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]