SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9VSW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9VSW6
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.78e-22
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 218-329
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000205
Family Calsequestrin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9VSW6
Sequence length 596
Comment (tr|A0A0D9VSW6|A0A0D9VSW6_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:LPERR03G12020.1} KW=Complete proteome; Reference proteome OX=77586 OS=Leersia perrieri. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Leersia.
Sequence
MGIPVRSLLVASFVLSSIALHVAAAKNSDPYKVLGVDKSASQRDIQKAFHKYVFPLQKRM
QFIFRSLSLKYHPDKNKGKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGNPGFDRGN
FGNREGYTYFTGGGPKNSYFSSGDGWQTMGGQGNTKTFSFSFGGNPGAGGGNQFGFDFGD
VFSNLFSGGSMGDSQHTGSADKARPGSKTSGHDSNSINIQEVTMQIFNKEITDQGITWLL
LFYTPNTKGQVVLESVVEDVARSLDGALRAGKVNCDHEKALCKKAGVSIGKSARLFIYSY
TTAEKGSFHEYSGEYDSKSLKTFCQEHLPRFSKRVDINQFSFPLNIIPNLPQVLLLSAKK
DTPAMWRAVSGMFRSRLIFYDAEVQDVSHPLLKRLGVKNVPALIGRSINGEEQLLKDGIS
VKDLRSGIKELKILLENFEKKNKKLASNQAKKPTHTNQPKENKVPLLTTSNFEEICGEKT
SVCIIGIFKSNKAKEKLEAVLSEISQKTLIRGQNYNSGNAVTYALLDGNKQSAFLSTFDK
SAFKSSDKLLLAYKPRRGRYAVYNSEVTLEEAERFVVSVLNGDVQLSSSGRKPVLK
Download sequence
Identical sequences A0A0D9VSW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]