SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9YVJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9YVJ8
Domain Number 1 Region: 214-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-22
Family UAS domain 0.00031
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000031
Family UBX domain 0.04
Further Details:      
 
Weak hits

Sequence:  A0A0D9YVJ8
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000194
Family UBA domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9YVJ8
Sequence length 621
Comment (tr|A0A0D9YVJ8|A0A0D9YVJ8_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM02G26060.5} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MDNAAAVATFMEITSCGSQEAAVQHLASCRWDLDAALNRYFIFGGVLAAAPSPAPVADVA
PPAALDDGVRAPIPARSDTLYGDMYGGARRRDRDSRPAPSVWEDEPPAVTPSVAPVYIQM
PSANPAVAPVQIQMPSETAASVPAAPVPVHAPSQPPVVAIAVKKEQNEKDEEEDNGRDDD
DDGYSDSDYGMDTDDDDDRYDECIEKTPSPPPKSTQQQATTLAEMYRRPRELMHDADFHS
TKVHAARQDRWLLLNLQSAGEFASQMHNRDLWADQVIARVVRESFVFSLLENSYGDDDDE
ASKVCCFYKLHDQLPAVLVIDPITGQMLAKWSGVIQPETFLVDIEEYSKSKPSMRSKPYI
FQRKPMPVRSAPAASEQHHQEPAMADTAAPMDIHNVQEPDTAAPAPAPVVEHGVQQPATA
GAGAQQPADEQDDDDQPMEGEKMYRMRVRFPDGSVVTKEFGCKRRVAVLFNYCRSVLHDK
PQAFKIKRLLGVGGAFHELPQGDHSLHHACEEAQLNSSKRKSLSLAAGRWGNDVAIGATT
VGEDFELAAGSGNTARKCGRRRLGLELAGGSGATTRNNRYQRGPELGGGGGVNVISLDVA
YVFALEWNTVQRFVKLRTSDV
Download sequence
Identical sequences A0A0D9YVJ8
OGLUM02G26060.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]