SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0BRZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0BRZ7
Domain Number 1 Region: 255-413,747-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.67e-67
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 2 Region: 503-743
Classification Level Classification E-value
Superfamily vWA-like 6.08e-63
Family Trunk domain of Sec23/24 0.0000172
Further Details:      
 
Domain Number 3 Region: 415-501
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 6.67e-26
Family Zn-finger domain of Sec23/24 0.00068
Further Details:      
 
Domain Number 4 Region: 892-1033
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.65e-17
Family C-terminal, gelsolin-like domain of Sec23/24 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0BRZ7
Sequence length 1076
Comment (tr|A0A0E0BRZ7|A0A0E0BRZ7_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM12G11430.2} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASPSRPPPPFAPQNPTPAPNPAASSLPASFSNLHVSRAPPPFAPPGGNGPVPSSIRAPQ
APPPGARPFPGSPPPPSQPPPPFARPAAPVQQQPPPFGGPPGVMPSQPLQQQQQQQRPAF
GGPPSGAPPAQAQRTPFGGPPSAMSQGPPPFGGPPAAVAASQPPPFGGPPVAAAQPPPFG
RPPSAAAAGQSAPLGGALFAAAQPPPFGGPPGAAPQPAPTGGLRTPYGGPPAPSQQVPFG
GAPQWPGTQPPPFGAQAAPSSQPPPFMGVPGNAPPFRPPGWQGQARPGAMSAGMQPMPGG
MLPNALGQGMPSTPSMPYSPHAGAQVSTPSKIDPNQIPRPMPETSVVIFETRQGGQAAVP
PAASSEFIVKDTGNCNPRLMRCTLNQIPCTGDILTTSAMPLALMVQPFALPHPSEEPIQL
VDFGGMGPIRCSRCKAYINPFMRFIDQGKHFVCNLCGFSNDTPREYLCNLGPDGRRRDAD
DRPELCRGTVEFIASKEFLVRDPMPAVYFFLIDVSMNAIQTGATAAACSAISQALSDLPE
GPRTMVGIATFDSAIHFYSLKRDQQQPLMLIVPDIQDVYTPLQTDLILPISECRENLEQL
LESIPNMFENNRVADSAFGAAMKASFLAMKSTGGKLLVFQSVLPSVGIGSLSAREAEGRS
NISTGDKEAHKLLQPVDKTLKTMALEFAEYQVCVDVFLTTQSYVDISSISVVPSTTGGRV
YHYYPFSALSDPAKLFNDLRWNFSRPQGFEAVMRVRCSQGLQVQDYSGNFCRRVPTDIDL
PAIDSDKTIMVTFKHDDKLQENSECAFQCALLYTTVYGQRRIRVINLSLSCTNVLSNLFR
YADLETQFTYVVKQALIKSVGLRTDGRLDDRSYWVSTVSSISVLLAIPLVFPRMIALHDL
ASRSDDDSLIPNPLTLNSENTLDFGIYLLENGEDGFVYVGNAVNPATLEQIFGVSSLAGV
PNQLVLEQYDNELSRKVNEVVNEIRRQRCSYLRLRPCKHGDPSGDFFRSLLVEDKAPGGL
SYVEFLEPQKKLISDDDTPKGMEQVLSKALIEMALGDFVADFPGFRNILKHRFMPR
Download sequence
Identical sequences A0A0E0BRZ7
OGLUM12G11430.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]