SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0EZ61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0EZ61
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-35
Family spliceosomal protein U5-15Kd 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0EZ61
Sequence length 142
Comment (tr|A0A0E0EZ61|A0A0E0EZ61_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI10G10560.1} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL
VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
RGARKGRGLVIAPKDYSTKYRY
Download sequence
Identical sequences A0A0D3HEX9 A0A0D9XKV4 A0A0E0EZ61 A0A0E0FFX0 A0A0E0M906 A0A0E0R0M1 A0A1E5VL61 B6T4C6 B8B881 C5YKW0 I1Q8W5 J3MJB5 K4AGE3 Q7X873
GRMZM2G108277_P01 OsIBCD022672 OBART10G13860.1 ORGLA07G0055700.1 39946.BGIOSIBCE024080 39947.LOC_Os10g34520.1 4558.Sb07g020280.1 4558.Sb10g007680.1 NP_001148867.1.34533 XP_002436726.1.57931 XP_002444330.1.57931 XP_004982785.1.39314 XP_006657540.1.55871 XP_015612821.1.37577 XP_015646995.1.37577 Pavirv00014263m|PACid:23799923 OMERI07G05290.1 OMERI10G10380.1 jgi|Sorbi1|5058721|Sb07g020280 jgi|Sorbi1|5061525|Sb10g007680 LOC_Os10g34520.1|PACid:21886447 LOC_Os10g34520.1|13110.m03073|protein OPUNC10G12310.1 OPUNC10G12320.1 GRMZM2G108277_T01|PACid:20866416 ONIVA01G02590.2 Si037950m|PACid:19679687 OB07G14970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]