SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0F4K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0F4K3
Domain Number 1 Region: 319-469
Classification Level Classification E-value
Superfamily ApaG-like 5.36e-24
Family ApaG-like 0.00036
Further Details:      
 
Domain Number 2 Region: 109-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000034
Family SMI1/KNR4-like 0.014
Further Details:      
 
Weak hits

Sequence:  A0A0E0F4K3
Domain Number - Region: 37-76
Classification Level Classification E-value
Superfamily F-box domain 0.00014
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0F4K3
Sequence length 469
Comment (tr|A0A0E0F4K3|A0A0E0F4K3_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI11G08090.2} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAPPRPQPEPEPEPPAAGLEALEGLALDTVIAKAGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRTLPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEALKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHCENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQGVFNMTNLIIVATSWYRPKTFFLNC
SDDQLYVGTINLQDGEMLPCVPKSLIRPTNTDMPQDGLLLWLEEHLRRLQNGMIKTRMLK
TSRYISLFPEASPSCTSAMTNCVKVRASAVFAPEHPESRRPGAKCLYAYSIRLSVPEACM
LGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEGVIGKVCGKQEEHSINYYPLLTPGQEEFV
YESCTPLPDSPGSVEGSFTFVPGMLSRPEGKPFEVTVAPFPLEIPEYIF
Download sequence
Identical sequences A0A0E0F4K3
OMERI11G07950.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]