SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0F7C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0F7C2
Domain Number 1 Region: 98-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000067
Family Thioltransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0F7C2
Sequence length 213
Comment (tr|A0A0E0F7C2|A0A0E0F7C2_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI11G15460.1} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGAAAKPPPFVCFKWPWGPDPKATSPSPSPSPCGDLEMPWLLKSIRTVAQGLLIAGDLPS
PSSDGGGGGGGARTRGRRRRRLGPGLAAEADRGEAEQRALAAALASGRDATVLEFYSPRC
RLCASLQGLVRELEDGAGGRAGFVLADAEDDRWLPELLHYDIRYVPCFVLLDKNGRALAK
TGVPTSRQHVIAGLHHLLNMNQISVQEGTKSTA
Download sequence
Identical sequences A0A0E0F7C2 A0A0E0J3U2 B8BEB0
ONIVA11G18340.1 OMERI11G15270.1 OsIBCD028042 39946.BGIOSIBCE029446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]