SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0F891 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0F891
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.2e-22
Family Thioltransferase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0F891
Sequence length 109
Comment (tr|A0A0E0F891|A0A0E0F891_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI11G17920.1} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAERVARLASERAVVVFTKSGCCMSTAVTTLLGELAVSAAVHELDREPLGKEMEKELARR
LYGSGGRGGPAVPAVFIGGSLVGGTSKVMAMHLKGELVPLLKSAGALWL
Download sequence
Identical sequences A0A0E0F891 A2ZGI2 I1R1V8
OsIBCD046250 ORGLA11G0175000.1 OMERI11G17740.1 39946.BGIOSIBCE035208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]