SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0GAB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0GAB2
Domain Number 1 Region: 214-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-22
Family UAS domain 0.00036
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000331
Family UBX domain 0.04
Further Details:      
 
Weak hits

Sequence:  A0A0E0GAB2
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000173
Family UBA domain 0.07
Further Details:      
 
Domain Number - Region: 163-202
Classification Level Classification E-value
Superfamily ARM repeat 0.0691
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0GAB2
Sequence length 569
Comment (tr|A0A0E0GAB2|A0A0E0GAB2_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA02G27980.5} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MDNAAAVATFMEITSCGSQEAAVQHLASCRWDLDAALNRYFIFGGVLAAAPAPAPVADVA
PPAALDDGVRAPIPARSDTLYGDMYGGARRRDRDSRPAPSVWEDEPPAVTPSVAPVYIQM
PSANPAVAPVQIQMPSETAASVPAAPVPVHAPSQPPVVAIAVKKEQNEKDEEEDNGRDDD
DDGYSDSDYGTDTDDDDDRYDECIEKTPSPPPKSTQQQATTLAEMYRRPRELMHDADFHS
TKVHAARQDRWLLLNLQSAGEFASQMHNRDLWADQVIARVVRESFVFSLLENSYGDDDDE
ASKVCCFYKLHYQLPAVLVIDPITGQMLAKWSGVIQPETFLVDIEEYSKSKPSMRSKPYI
FQRKPMPVRSAPAASEQHHQEPAMVDTAAPMDIHNVQEPDTAAPAPAPVVEHGVQQPATA
GAGAQQPADEQDDDDQPMEGEKMYRMRVRFPDGSVVTKEFGCKRRVAVLFNYCRSVLHDK
PQAFKIKRLLGVGGAFHELPQDDVAIGATTVGEDFELAAGSSNTARKCGRRRLGLELAGG
SGATTRNNRYQRGPELGGGGGVNVTRRYR
Download sequence
Identical sequences A0A0E0GAB2
ONIVA02G27980.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]