SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0GGE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0GGE2
Domain Number 1 Region: 85-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.39e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00061
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000101
Family Glutathione S-transferase (GST), N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0GGE2
Sequence length 225
Comment (tr|A0A0E0GGE2|A0A0E0GGE2_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA03G02370.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAGLQVFGQPASTDVARVLTCLFEKNLEFELIRIDTFKKEHKLPEFIKLRDPTGQVTFK
HGDKTLVDSRTICRYLSTQFPDDGNRTIYGTGSLERASIEQWLQAEAQSFDAPSSELVFH
LAFAPQLNIPADEARIAENERKLQQMLNVYDEILAKNKYLAGDEFTLADLSHLPNSHYIV
NARSPRGKKLFTSKKHVARWYEEISNRASWKQVVKMQSEHPGAFE
Download sequence
Identical sequences A0A0E0GGE2 A2XC67
OsIBCD008773 ONIVA03G02370.1 39946.BGIOSIBCE009550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]