SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0H502 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0H502
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.19e-24
Family Arfaptin, Rac-binding fragment 0.063
Further Details:      
 
Domain Number 2 Region: 263-359
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0H502
Sequence length 370
Comment (tr|A0A0E0H502|A0A0E0H502_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA04G21790.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MEAIRKQASKLREQVARQQQAVMKQFGGGYGADGAFADEAEAQQHSKLEKLYISTRAAKH
FQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGAENTCTSGSTLSKAALCFAKARSLME
KERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAIEVSKRQMKLRE
TSGNGDMISRLEAAESKLQELKSNMGVLGKEAVASMTAVEAQQQRLTLQRLIAMVESERS
YHQRVLQILDQLEREMVSERQRIEGAPPPAVESSMPPPPSYEEINGVFMRNPTVAELVET
VEFFLAEAIQSYRAESETELNLAAGDYIVVRKVSNNGWAEGECRGKAGWFPYDYIEKRDR
VLASKVAQVF
Download sequence
Identical sequences A0A0D3HFK1 A0A0E0BCM1 A0A0E0H502 A0A0E0M9P0 A0A0E0R1B8 B8BHV1 Q337C1
39946.BGIOSIBCE032741 39947.LOC_Os10g36870.1 LOC_Os10g36870.1|13110.m03347|protein OsIBCD031185 ONIVA04G21790.1 OBART10G15530.1 OGLUM10G15420.1 OPUNC10G14070.1 XP_015612895.1.37577 LOC_Os10g36870.1|PACid:21884536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]