SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0HIC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0HIC8
Domain Number 1 Region: 87-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 8-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.93e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0HIC8
Sequence length 241
Comment (tr|A0A0E0HIC8|A0A0E0HIC8_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA05G27510.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAGKDDDVKVLGLVMSPFAIRVCIALKLKGVSYEYIEEDLANKSELLLSSNPVHKKIPVL
IHGGKPVSESLVIVQYVDEAWAPSPTSPSILPADPYDRAVARFWAAYVDDKMVPGMVGVL
RAATEEERAAKADETLAAMAQLEKAFAEVAAKNGKPFFGGDTVGYVDLALGCNLHFLEAI
RRLHGVALVDAGKTPLLAAWAERFVEVEAAKGVVPDADDAVEFARKVQARVAAAAASTAA
K
Download sequence
Identical sequences A0A0D3HFW4 A0A0E0HIC8 A0A0E0R1Q4 A2Z9L8 Q8S718
XP_015614528.1.37577 39946.BGIOSIBCE032855 39947.LOC_Os10g38700.1 LOC_Os10g38700.1|13110.m03525|protein LOC_Os10g38700.1|PACid:21885848 OsIBCD031290 ONIVA05G27510.1 OBART10G16490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]