SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0HIC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0HIC9
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 8-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0HIC9
Sequence length 230
Comment (tr|A0A0E0HIC9|A0A0E0HIC9_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA05G27520.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAGRNNHELKLLGTWPSPFVVRVRLALGLKGLSYEYVEQDIRDKSELLVVSNPVHKKVPV
LIHGGKPVCESQIIVQYIDEAFPGAGASLLPSDPHERAVARFWATYIDDEFATKFRAMGE
AKEEEEKDEAAAQVFAALETLEEAMKGKVFFGGDSAGYVDVALGGFLGWIKAAEALAGVA
FLDGARTPLLAAWAARFSALEAAKEAIPSVERLREFHVAMHAAAATVAGN
Download sequence
Identical sequences A0A0E0BCY9 A0A0E0HIC9 A2Z9L7
ONIVA05G27520.1 OsIBCD031289 39946.BGIOSIBCE032854 OGLUM10G16480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]