SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0I2B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0I2B2
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-55
Family Atu2684-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0I2B2
Sequence length 273
Comment (tr|A0A0E0I2B2|A0A0E0I2B2_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA07G16930.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAPRLLSCFGRGSATASAPDQPEEAAAAAAPGPVLLELFCSQGCGASPEADAVAARMVHE
DQQRAAAGEGGGGERGVVVLGFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLDTLFTP
QAVVQGRAHCVGTEQDALAQAVRDAPRYPAPAMKVTFQRPNPSTLQASFTGTLRSRMEGG
GSVLVALYESGLVTDCGRGENKGKSLLNDHVVRRLEKVAAVRDGASAKKSVSGSVQFPLW
DGFRASRCGLVLFVQNAALQVLGVQHFDLPDNV
Download sequence
Identical sequences A0A0D3GSD3 A0A0E0I2B2 A0A0E0Q9V1 A2YML6 Q6Z402
ONIVA07G16930.1 LOC_Os07g37310.1|13107.m03838|protein LOC_Os07g37310.1|PACid:21900955 39946.BGIOSIBCE025231 39947.LOC_Os07g37310.1 XP_015645139.1.37577 OsIBCD023884 OBART07G18540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]