SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0I5T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0I5T5
Domain Number 1 Region: 86-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-24
Family Thioltransferase 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0I5T5
Sequence length 279
Comment (tr|A0A0E0I5T5|A0A0E0I5T5_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA07G26370.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAEALCSGSVASPCGEVGVGFAAGLVRGAAAAAALAESVPIGGYSSKSTFPSGRVALTER
KARPLPRNLEAAHGQMNLTIGKAMRWWEKCLQPNMREIESAQDLADSLLNAGDKLVVVDF
FSPGCGGCRALHPKIAQLAEKNPEVLFLQVNYEKHKSMCYSLHVHVLPFFRFYRGAQGRV
SSFSCTNATIKKFKDALAKHGPDRCGLGPAKGLEESELMALAINRDLNFTYTPNQDLVPI
ADALLKEAAAPGGPWLPLPATATQLFIQGSENSLLSSGR
Download sequence
Identical sequences A0A0E0I5T5 A2YQ16 Q6Z4N3
LOC_Os07g48510.1|PACid:21902045 LOC_Os07g48510.1|13107.m05197|protein OsIBCD024632 39946.BGIOSIBCE026078 39947.LOC_Os07g48510.1 XP_015646723.1.37577 ONIVA07G26370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]