SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0IGC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0IGC9
Domain Number 1 Region: 60-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.06e-28
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0IGC9
Sequence length 164
Comment (tr|A0A0E0IGC9|A0A0E0IGC9_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA09G01170.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MPPRSLTLSRLPVAALGLPFSSCSPPPPRLRFPIAARRARSLATRASSSSPDSSFGSRME
DSVKRTLADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDQLGAQGPQLQKVLERLT
GQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSELDIDVNNS
Download sequence
Identical sequences A0A0E0IGC9 A2YY90
39946.BGIOSIBCE028921 OsIBCD027446 ONIVA09G01170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]