SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0LL46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0LL46
Domain Number 1 Region: 43-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.81e-43
Family PAPS reductase-like 0.0042
Further Details:      
 
Domain Number 2 Region: 310-423
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.63e-23
Family PDI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0LL46
Sequence length 425
Comment (tr|A0A0E0LL46|A0A0E0LL46_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC07G14550.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASATASISSHSVALRDLKAARIGAVKQQAPAAAVEAPATAVDYEALAQEMQGASPLEIM
DRALAMFGSDIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDKVEKHYG
IRIEYMFPDAGEVQALVRAKGLFSFYEDGHQECCRVRKVRPLRRALRGLRAWITGQRKDQ
SPGTRASIPVVQVDPSFEGLAGGAGSLIKWNPVANVDGKDVWTFLRAMDVPVNALHAQGY
VSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDKEGSQGGAVAHKAGANGNG
SAGAPDIFESNDVVNLTRAGIENLLRLENRAEPWLVVLYAPWCPFCQAMEASYVELAEKL
GGAGAGVKVGKFRADGEQKAFAQQELQLQSFPTILLFPSRTARPIKYPSEKRDVDSLLAF
VNSLR
Download sequence
Identical sequences A0A0E0LL46
OPUNC07G14550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]