SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0M906 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0M906
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-35
Family spliceosomal protein U5-15Kd 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0M906
Sequence length 142
Comment (tr|A0A0E0M906|A0A0E0M906_ORYPU) Uncharacterized protein {ECO:0000313|EnsemblPlants:OPUNC10G12320.1} KW=Complete proteome; Reference proteome OX=4537 OS=Oryza punctata (Red rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL
VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
RGARKGRGLVIAPKDYSTKYRY
Download sequence
Identical sequences A0A0D3HEX9 A0A0D9XKV4 A0A0E0EZ61 A0A0E0FFX0 A0A0E0M906 A0A0E0R0M1 A0A1E5VL61 B6T4C6 B8B881 C5YKW0 I1Q8W5 J3MJB5 K4AGE3 Q7X873
OMERI07G05290.1 OMERI10G10380.1 GRMZM2G108277_T01|PACid:20866416 OsIBCD022672 NP_001148867.1.34533 XP_002436726.1.57931 XP_002444330.1.57931 XP_004982785.1.39314 XP_006657540.1.55871 XP_015612821.1.37577 XP_015646995.1.37577 ORGLA07G0055700.1 ONIVA01G02590.2 GRMZM2G108277_P01 Si037950m|PACid:19679687 OBART10G13860.1 Pavirv00014263m|PACid:23799923 LOC_Os10g34520.1|PACid:21886447 OPUNC10G12310.1 OPUNC10G12320.1 jgi|Sorbi1|5058721|Sb07g020280 jgi|Sorbi1|5061525|Sb10g007680 LOC_Os10g34520.1|13110.m03073|protein OB07G14970.1 39946.BGIOSIBCE024080 39947.LOC_Os10g34520.1 4558.Sb07g020280.1 4558.Sb10g007680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]