SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0N4F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0N4F9
Domain Number 1 Region: 260-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000961
Family Thioltransferase 0.076
Further Details:      
 
Weak hits

Sequence:  A0A0E0N4F9
Domain Number - Region: 40-50
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0N4F9
Sequence length 332
Comment (tr|A0A0E0N4F9|A0A0E0N4F9_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI01G39250.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN=4327529 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MLRLPTLLPLKPSPPTTGLNPIHGRRHGHHPSRLLASSAPPPPPPRPPKPEPRTSHENLG
DDTPDFPTTKPRKPRRGRRSEAAAVEDFVRGRLEQVFASIRERDPEVLEGKGDILKRKEE
LSDEEGKEGTGEEEGELKAVVEEEDPSWPLDADIGWGIRASEYFDKHSIKNVTVDGVEID
WEREVEEGWVKEINCLEWESFAFHPSPLIVLVFERYNRAADNWKFLQELEKAAKVYWNSK
DRLPPRVIEVVGHMLNLIEFQTVKVDMNIERDLAFALQVKECPQLLFLRGNKILYREKEL
RTADELVQMIAHFYYNAKRPSCVNPEAIAPPC
Download sequence
Identical sequences A0A0E0FV92 A0A0E0N4F9 A2Z5H3 A2ZZ71
OsIBCD029889 39946.BGIOSIBCE031415 ONIVA01G40860.1 ONIVA01G40860.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]