SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0NHU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0NHU5
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0NHU5
Sequence length 133
Comment (tr|A0A0E0NHU5|A0A0E0NHU5_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI02G25610.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGMAQSSSSSSRPSDSEQLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLA
ELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVP
LLTEAGAIATPSL
Download sequence
Identical sequences A0A0E0IKH4 A0A0E0NHU5 I1P291 Q6K953
LOC_Os02g40500.1|PACid:21920399 ORGLA02G0209700.1 ONIVA09G12430.1 OsIBCD007238 39946.BGIOSIBCE007836 39947.LOC_Os02g40500.1 XP_015626005.1.37577 LOC_Os02g40500.1|13102.m04514|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]