SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0P2N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0P2N0
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-30
Family Thioltransferase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0P2N0
Sequence length 134
Comment (tr|A0A0E0P2N0|A0A0E0P2N0_ORYRU) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MGSFFSTMFTPPPAADDGGDSRVVAVHSTATWDEQWGAHKSNPNKLIVIDFSATWCGPCR
FIEPAFKDMAGRFADAVFFKIDVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDE
LERKVNMFISSSSS
Download sequence
Identical sequences A0A0E0GV23 A0A0E0P2N0 B8ALD1 Q851R5
39946.BGIOSIBCE013316 39947.LOC_Os03g58630.1 LOC_Os03g58630.1|PACid:21917582 OMERI03G34320.1 XP_015631704.1.37577 ONIVA03G39070.1 OsIBCD012287 LOC_Os03g58630.1|13103.m06438|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]