SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0PL50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0PL50
Domain Number 1 Region: 37-163
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-44
Family Ran-binding domain 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0PL50
Sequence length 220
Comment (tr|A0A0E0PL50|A0A0E0PL50_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI05G13820.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MADKEPVVDRPEDEEEASAAAAAAGGEEEDTGAQVAPIVRLEEVAVTTGEEDEDVLLDMK
AKLYRFDKEGNQWKERGTGTVKLLKHKENGKVRLVMRQAKTLKICANHLVASTTKMQEHA
GSDKSCVWHAADFADGELKEEMFAIRFGSVENCKKFKDLVEEISESLAKTEGKETEEDSS
AAGLLEKLSVTEKKSEEVATKEESTEAVKETDTKSAATSE
Download sequence
Identical sequences A0A0E0PL50 Q0DIY4
39947.LOC_Os05g28290.1 XP_015640665.1.37577 LOC_Os05g28290.1|PACid:21941421 LOC_Os05g28290.1|13105.m02912|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]