SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0PX36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0PX36
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-16
Family Txnl5-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0PX36
Sequence length 139
Comment (tr|A0A0E0PX36|A0A0E0PX36_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI06G13510.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MTVEKVDATVADFDAHFDKLFAAGDDAEGKVKLLLFLADRDASSNQTWCPDCNVAEPVIY
DRVEAAAKGKEKDVVLLRAYVGDKPTWRDPAHPWRADPRFRLTGVPTLIRWENGAAAARL
GDDEAHLADKVDAVVNAAN
Download sequence
Identical sequences A0A0E0A8V3 A0A0E0G4R3 A0A0E0PX36 A2YCB4 Q5Z9Z3
XP_015641897.1.37577 LOC_Os06g21550.1|PACid:21933184 39946.BGIOSIBCE021693 39947.LOC_Os06g21550.1 ONIVA02G13070.1 OsIBCD020370 LOC_Os06g21550.1|13106.m02307|protein OGLUM06G13660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]