SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0QTK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0QTK0
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.38e-22
Family BAR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0QTK0
Sequence length 627
Comment (tr|A0A0E0QTK0|A0A0E0QTK0_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI09G17190.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MKSSLRKLRGFALQRHEQRVDRRGGHSPAAAAAANELLAASQDMADMRSCYDNLLSVAAA
IANSAYEFSEALQEMGTCLLKRVTPNKDGINDKVLLLLGKAQFELRKLVDSYRVHVLNTI
TTPSQSLLNELQTVEEMKHQCDEKRELFEFLLNAQKEKGRSKNAKSDIGASEQLKQAQDD
YQEEATLFLFRLKSLKQGQFRSLFTQAARHHAAQLNLFRKGLKSLEAVEPHVRLAAEQQH
IDHQFSALDEEDYSVDEENEDDYNDSHEDLSFDYGENKEGTEAGHASRSPTEELLDRSKA
EYSSFPGERQRSGSQSAPLFPEKKLEAAERIKELRRSATRKLYTYVLPTPNDVRDTSQTV
TANPTSGSPLGNKGAFYSSPLQPSTNVGDLRDNKLPSPTRLSNAHSVLKESNTNTTDTRT
MLVLPLGDLSLPGYHDSKASDNKKVKRGSFSGPIVPRSRSTENIDVVSVPPRHSSSHQPS
IHVRVSPNTSPPLLSSPKIKELHELPRPPANASKHTTFPSLVAHSAPLVPNSAPLAPRGQ
DHFRPRQTPPSAPQTASPLPTPPGPISRSFSIPSRGMRTSGISDGKETEDLQDKGPARMS
LSSLPSAQTSLEDHRPLSGATESVSKT
Download sequence
Identical sequences A0A0E0QTK0 Q0J0H3
LOC_Os09g33510.1|PACid:21925480 LOC_Os09g33510.2|PACid:21925481 39947.LOC_Os09g33510.2 XP_015612244.1.37577 LOC_Os09g33510.1|13109.m03331|protein LOC_Os09g33510.2|13109.m07549|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]