SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0R6P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0R6P8
Domain Number 1 Region: 304-439
Classification Level Classification E-value
Superfamily ApaG-like 2.62e-17
Family ApaG-like 0.0044
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily F-box domain 0.00000687
Family F-box domain 0.014
Further Details:      
 
Weak hits

Sequence:  A0A0E0R6P8
Domain Number - Region: 125-219
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000334
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E0R6P8
Sequence length 442
Comment (tr|A0A0E0R6P8|A0A0E0R6P8_ORYRU) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI11G09540.1} KW=Complete proteome; Reference proteome OX=4529 OS=Oryza rufipogon (Brownbeard rice) (Asian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASPAKAQRRPEGASVLETLPALPLAIIIAKAGPRCAAALACASSTLRAAASGEALWRRF
CSDDFALDAPLAPGDLPLPSFKDAYKAWFQSFGMYPLPLVKRVKIFWSSFRAWLCEYFPE
GLRTLGEGVSEAEIAVTECNLGLVLPMPTKLLYRFCNGQLHIGRGEEVSYGVMGGYDYVH
QRYTVRLLPLAHHAVQKNSNYIVVATSCFGEKIFLLDCASGRLYVGTKYWNEEREIMACV
PKASIRLAVDDDHGMPQDGFLLWLEEHLSRLQDGLIKVQSCKFPMLARHISLYPVQLPYC
SSTSMHGIKVRASAVFAPENSAFADYRCRYSYYFSIRLSLAEAFVVDGKWYSSFQLQSCH
YTIQIGDEVLPYTCNYGGHGKCPLLRCGEELFVYGCSISAALEPGSVMGNLTLVPWRCGQ
PRGSPFIADIAPFPLHPPDYIF
Download sequence
Identical sequences A0A0E0J0H6 A0A0E0R6P8
ONIVA11G09040.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]