SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2ZKS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E2ZKS3
Domain Number - Region: 286-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0254
Family Thioltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2ZKS3
Sequence length 636
Comment (tr|A0A0E2ZKS3|A0A0E2ZKS3_9GAMM) Thiol-disulfide oxidoreductase {ECO:0000313|EMBL:KFI18897.1} KW=Complete proteome OX=314279 OS=Nitrosococcus oceani C-27. GN=IB75_11390 OC=Chromatiaceae; Nitrosococcus.
Sequence
MYQKVFSLVKIGLEKQVPALGLGVFRIFLGLVILQEIVFLYYFRHLIFDTIPFIDVASPS
IYFFLILWGINTLFLTTGYHTRLAAIVNYFFWVIFTAFTPMWRDFDGGFDQFMIGSSFLL
IFLPTERAFSLDNLRVRLKFLKSELHHDPVSTVSVLSYYLPLAISLGLIYFDSAVHKLFA
EHWRNGLGAWLPLTMPYYISAIDMTWFLNQEFLQKFIGYLIIVFEFIFIFTFYLRSFRVP
LMITGISLHSGIILSLNIYPFGFGMLVYYFLMVPFSWWQGLKKTLQFKSPQLVVFYDQQC
PLCNRTRIIIEHFDIFKAINFEGLQKRAKKYPELNNISEEQLLKDIYALDQKGHLYVGID
AYLQILLKMKYPALAGIFIRIPGVYHFGKKIYRRIADQRARLTCDESCFVSSENSLQEAY
SFKRSYEYYAGTKKQRSNRITKFLVLIMLLQLNSTIHYGIFYRLNEDGAESEIGQILSPI
SNAVLFLSHAFLGITPHALYMHDHFHGYNHILALTYKNSQGQEQWLPFVNEEGRLVAPNW
GRVQSMWANVAVTPHIEQRRLYKFIKKMTAFWGKKIDLDLQDTEFIIKMKRIDVPVHWER
NLRNKNINRPWVNIGRVIWHKGLARIEIQDINLESL
Download sequence
Identical sequences A0A0E2ZKS3 Q3J9A0
gi|77165601|ref|YP_344126.1| WP_002810144.1.20919 WP_002810144.1.77844 WP_002810144.1.91979 323261.Noc_2136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]