SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E2ZNN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E2ZNN5
Domain Number 1 Region: 6-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-57
Family Glutathione peroxidase-like 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E2ZNN5
Sequence length 193
Comment (tr|A0A0E2ZNN5|A0A0E2ZNN5_9GAMM) Alkyl hydroperoxide reductase {ECO:0000313|EMBL:KFI19997.1} KW=Complete proteome OX=314279 OS=Nitrosococcus oceani C-27. GN=IB75_05075 OC=Chromatiaceae; Nitrosococcus.
Sequence
MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALS
QFAREYQPKGLAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAA
CTPDFFLFDKNHKLVYRGQFDDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCN
IKWKPGNEPDYFG
Download sequence
Identical sequences A0A0E2ZNN5 Q3JCE8
323261.Noc_0989 gi|77164503|ref|YP_343028.1| WP_011330535.1.20919 WP_011330535.1.60716 WP_011330535.1.77844 WP_011330535.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]