SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3WHS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3WHS0
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-37
Family SMI1/KNR4-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3WHS0
Sequence length 146
Comment (tr|A0A0E3WHS0|A0A0E3WHS0_9BACL) Uncharacterized protein {ECO:0000313|EMBL:CQR55773.1} KW=Complete proteome; Reference proteome OX=1073571 OS=Paenibacillus riograndensis SBR5. GN=PRIO_3370 OC=Paenibacillus; Paenibacillus sonchi group.
Sequence
MIYEKLKSLIQENFDEGDFTGGITAEEVIKIESALNVEFPQSYRWFLKNYGSGGLFGVDI
LGCGKSSPSVVSKTEKLRNLGMPYGYIVIEDCEEFFYCLDTTDISNGECSVISWDRISGF
NGIRADNFYKFLFERLSDAKENWEED
Download sequence
Identical sequences A0A0E3WHS0
WP_046503573.1.67059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]