SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E3YNA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E3YNA4
Domain Number 1 Region: 218-280,311-365
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000497
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 23-61,89-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000314
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E3YNA4
Sequence length 372
Comment (tr|A0A0E3YNA4|A0A0E3YNA4_XANCA) Glucan biosynthesis protein {ECO:0000313|EMBL:AKC79112.1} KW=Complete proteome OX=339 OS=Xanthomonas campestris. GN=XB05_10445 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAALKWMIYGRSPSLATFWDEALNLGRVPASEAAIAAAQARLGVRLPAWLRSLYARYDGG
AVQMARGQSLEEPDNWLKAEWLIPRARLLGSAELFSFAQVRAREDYRDDAFAGLAAGSDD
GRLIVIAADDRAPSRALCLDYSVSDVEPTVVYVDAGNNRRLAEFANVDALLSQLVDVHYW
SPALQAKHDGDVVRWQPQPPALTTFWSGAGYWNDGGAAADASVLAATEARLGVRLPALFK
QLYSVQDGGDTGWCWVPRTRFPSDLYVDWECVLVDRYLSPLAKIGSLLDLAAAFEDPDDF
SAAACLHAGLDRVLVLSSHNIDCLLCLDYRARGPQCEPDVVYFDRWEGLVPTWRAPSFDA
FFSVLRQADLDC
Download sequence
Identical sequences A0A0E3YNA4
WP_046343850.1.53125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]