SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2MCF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2MCF0
Domain Number 1 Region: 206-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.13e-37
Family Glutathione peroxidase-like 0.0019
Further Details:      
 
Domain Number 2 Region: 50-146
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.56e-19
Family FAD-linked reductases, N-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000471
Family PHBH-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2MCF0
Sequence length 402
Comment (tr|A0A0F2MCF0|A0A0F2MCF0_SPOSC) Uncharacterized protein {ECO:0000313|EMBL:KJR87383.1} KW=Complete proteome OX=1397361 OS=Sporothrix schenckii 1099-18. GN=SPSK_01764 OC=Sporothrix.
Sequence
MVRLYIQIASSTDSDFNPRKTASEEEVQAHAKKILQPYSIEWERVEWYSVYPIGQGISDN
YTLDHRVFLGGDACHTHSPKAGQGMNTAFLDAQNLAWKIHLVEKGFANRSLLQTYQFERK
EVAETLLSFDNKYAKLFSEKPPAASMVEAATESKAPSNPSSEEQHDNAFVQVFKESCEFT
SGYGVKYQPSLITWSPDHPAQLATVDPEANKLRPGRLLTNADVTRVVDANVVHLEQEVPM
NGSFRIFIFAGKASTTAAALRDLESGMRKRNSFYASYQRADVDTVSYHEKHNPHSLFYTF
CVIFAGRRQDIEISRDVPGLLTRYRDHVYADDRRSYRVPDARASAHVKMGFDEDHGGVVV
VRPDGYVGIVTSLVEGSGTLDALNAYFGSFCTKKLGQESAQL
Download sequence
Identical sequences A0A0F2MCF0
XP_016590059.1.8583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]