SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6P8G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6P8G3
Domain Number 1 Region: 70-279,311-354,384-504
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-84
Family Duffy binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 497-569,604-664
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000106
Family Duffy binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6P8G3
Sequence length 665
Comment (tr|A0A0F6P8G3|A0A0F6P8G3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AJD77409.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var44 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEPQIGGRGGDNADKYKNATNVKDLLDMIGKDVHEEVEKKADGTGDSGDSKKYREELKGD
LNTANNSSEETASSLKTCDLVDEYSNKADDISERHPCRKSGEDVKRFSDTQGAECHWRKI
KDSKNYCGACAPYRRLHVCDKNMEKMEKTSKTSTDTLLAEVCYAAKHEGESLRSQHGQHQ
LTNLGSTICTVLARSFADIGDIVRGRDLYRGDNREKTKLEKNLKTIFEKIYNNLNNPKAK
THYEDKDPEKNFFKLREDWWTANRHTVWKAITCGAYDGDTYFRVTCNDNGTLSHANHKCR
CKKNDGKDDTDQVPTYFDYVPQFLRWFDEWTEYFCRLRKKKLENAIKNCREKDKEGKPRY
CDLNRHDCVKTIRGDDRFVEDDVCKNCHFSCSHFVKWIDKQKVEFDKQKRKYTSEITGGS
GRSRRRKKRSSSSSNSDDNGYENYFYEKLKEVGYQDVDSFLEKLNKETTCKDPPQVGTEK
ANPADFTKDTHTTFSHTEYCQACPWCGVQKKSNGGNGWEPKSDTTCAKRNKKEYYPEKTT
TIEILTADKTEGDMVRKYKRFCDSVKATVNGGGSVPSGHVASGGDSGGAANSTIPGTAKG
GATGGKGENGAPGKNGNQIVTWQCYYDKEKPSSENNDNCVEGTWQNFTGKETVKSYNVFF
WDWVY
Download sequence
Identical sequences A0A0F6P8G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]