SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6P8S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6P8S1
Domain Number 1 Region: 43-263,295-344,367-483
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-80
Family Duffy binding domain 0.00043
Further Details:      
 
Domain Number 2 Region: 476-682
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-32
Family Duffy binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F6P8S1
Sequence length 845
Comment (tr|A0A0F6P8S1|A0A0F6P8S1_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AJD77382.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var136 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DDKDAKRLLDSIGERVYKEKVQSDGETYKNKLKGNLKEAKGSEELASSIETCKLVDEYSN
KADDISERHPCKELSGNVGENRFSDTLGGQCTDSKIKGNKNNCGACAPYRRLHLCHHNLE
KITDTNKTTTHNLLAEVCYAAIHEGESLRGQHGEHQLTNKDSQICTVLARSFADIGDIVR
GKDPFYGNDEEKKQRKQLDKKLKVIFKKIYKDLTKTSGKTNGEIEARYKKDDDPDYFQLR
EDWWDANRLEVWKAITCGAGQNDKYFRQTCDDNGTSSNANHKCRCKDKKGEHDTDQVPTY
FDYVPQFLRWFEEWAEDFCRLRKHKLKDAIKKCRYDESDKKKYCTLNGYDCTKTVRGENK
LVSDSDCTKCSSSCIPFVDWIDNQKLEFLKQKNKYADEIKKDHGTTLQVGKTTINNLYVD
DFYKKLKQAQYKDVGTFLGKLSEEQICKNQPYNDERTIDISFNKNKSEPIDIFSHTEYCE
PCPWCGVEPGGPPWRAIDESTCRKGEIKTFDDTNTTPISRLSPDRRKRNILQKYNTFCVD
TENKYKEIKTWKCHYDDNDIYDKSDDSNDCVLGDWENLTKEDKIMSYYSFFWSWVDQMLD
DSIDWRTQLNNCMNYAKSNQCMKRCKSPCECYKKWVKHMRTEWIQIEKHFDKQKNITKLE
RYITLQTILKEFFMDKIKKAYGEKEESKELEAKLNSIEGFHEGADTEHSDDAIKFLLKHE
DEIAETCKKIHNDANCQQQESLARSAGTSPQTPKDEESGDDDPNNADSSDDDDEGEDEEE
EKEDNGDDQDQAVDATVNGEVAQPEPTTDKTTPPDVCKIVGGILTKDKLQDACKTKYDGK
YYGWR
Download sequence
Identical sequences A0A0F6P8S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]