SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6P8Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6P8Y4
Domain Number 1 Region: 58-443,474-493
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-83
Family Duffy binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 486-695
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-32
Family Duffy binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6P8Y4
Sequence length 816
Comment (tr|A0A0F6P8Y4|A0A0F6P8Y4_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AJD77426.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var98 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPKAPVTDYSDAPDAKHLLDMIGETVQEKVHKEDADYRNYLQGHLEDARFEKDPDGQQT
EKDPCKLNHEYHTTVTSGYNKENPCGNRPDVRFSDTEGAACDNRKIRDNDKKSNGGACAP
FRRLHLCDYNLENINIKKKIDNDTLLADVCLAAKFEGESLTRYRAQYQQTNPDSHYEICT
ELARSFADIGDIVRGKDLFLGNSKEKKQRKQLEENLKNIFANIYEKLKYKEGAQKRYGSD
KDFFQLREDWWNNNRKMVWYAITCGAAGGKYFRKTCGKNDDWTEGNCRCPANIRVPTYFD
YVPQYLRWFEEWAEDFCRKKKKKVENLQKQCRDYEQNLYCSGNGLDCQQTIRVIGHHVIG
SECTKCSFLCGFYKKWIDNQKKEFEKQKEKYTKEITGGGGRKKGSTSTTKYEGYEKKFYE
ILKSNNVGGLHKFLELLNKEKACTAITDGGTIDFKQVNSGKNGGGVAASGGASADSNNSN
KTFSHSEYCEECPLCGVEKGNNGNDWKDKDKSGKCKGEKLYNIPNNTPHNDIPVLSFGDE
RHQIKNKIDEFCDKKDNDREMEELTEKWKCYEFKHLDKVVKENDKDYTNIQTGGGLCILE
NPKKKEKEKTKKSEEEPKEIQKTFNDFFHFWVRHLLNDSIEWREKFGKCLENGKKTCKNN
KCNRECGCFLKWVNEKKDEWHEIKKHFDTQDFGEGKLFGAFTAYVALELVLELEYFPLIK
EAYGDARAIQGINKTLDKKKKEPDADISTTKTIIDYLLDHEKKDANKCKQKQEECNRQQE
NRARSNTSPDDQPAATESASDDHSENDDEDGDEVAE
Download sequence
Identical sequences A0A0F6P8Y4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]