SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7SAJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7SAJ8
Domain Number 1 Region: 213-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000492
Family Thioltransferase 0.059
Further Details:      
 
Domain Number 2 Region: 439-519
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000682
Family UBX domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7SAJ8
Sequence length 575
Comment (tr|A0A0F7SAJ8|A0A0F7SAJ8_9BASI) Uncharacterized protein {ECO:0000313|EMBL:CDW97688.1} OX=49012 OS=Sporisorium scitamineum. GN=SPSC_01367 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Sporisorium.
Sequence
MATQRSGSQQDAIASLRSVLQSYGGSVPDDDLLATLLEVEGWDVTRAARLVEEDTTAERR
RSGADDETIARSFAQDPQIRGSMDLDQSMTYDASRRTFEHGTGAPSGRPGGAGLRPYSRP
ADNSSNMGVAQMIWTALAFPLSLASSLLLFLARVLRIRALFPSLFGGSTGSQSLGRSDPQ
SCAEAFVRELEEETGATTSRSVVPTDNLGSRAPPPKKLPPFFVGGYADALRAAKEQIKIL
AIVLISREHGDVDRFKQNTLTDSDLVELLSRDDFIVWGGDVREREAYQVATTLQAITYPF
VAFIALQPSRSSSRSSAASASSSPRAAVLSRLEGSPASATSAGTIASHISDVLLPRTRTY
LDRLRAEKRRREMERQLRAEQDRAYQEASRRDAERIAARREQERLKALEAQRLREEQEQQ
EQLQRKRLAWQKWALQHLVPAEPSSSSESLRLSFRLPSGKTLTRRFSPADTVAEVFAFVE
ASSIAAEGAVVSSSQKPEGYEHEYRFSLVTGYPRKRIEVAQVGVQQLQDVDGLAKGGSLI
VEGSVMGDNEAATDDETDDDDDDENHGGSSMAKLP
Download sequence
Identical sequences A0A0F7SAJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]