SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7UTQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7UTQ6
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-36
Family Ran-binding domain 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7UTQ6
Sequence length 212
Comment (tr|A0A0F7UTQ6|A0A0F7UTQ6_TOXGV) Ran-specific GTPase-activating protein,putative {ECO:0000313|EMBL:CEL71417.1} KW=Complete proteome; Reference proteome OX=432359 OS=Toxoplasma gondii (strain ATCC 50861 / VEG). GN=BN1205_014550 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSDAATEPKPAQPAEATQATKEEEDNFNPEEEVTEGNWNTPQVEVHAVQVETGEEDEDVF
WKHRSKLYRWVSSTGDAQAAGEWKERGIGDAKLLRHKETGKIRFLLRQEKTLKIVANHYV
VASGVYCKLTPNVSSEKIWVWTVMDFAEGELKNEQFALKFGQVEQAQEFKKKFEEAAALN
AKIFGVEAEGEEKTEKEEKKEKEEEKKEKEEK
Download sequence
Identical sequences A0A086QP74 A0A0F7UTQ6 A0A125YKE1 A0A125YKE2 A0A139XJB6 A0A151H9G7 Q1JT32
XP_002370136.1.89292 gi|211967800|gb|EEB02996.1| gi|237841677|ref|XP_002370136.1| gb|TGME49_093340 gb|TGVEG_014550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]