SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8ALS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8ALS1
Domain Number 1 Region: 910-1213
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000487
Further Details:      
 
Domain Number 2 Region: 1169-1493
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000145
Further Details:      
 
Domain Number 3 Region: 53-214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-39
Family MAM domain 0.00000656
Further Details:      
 
Domain Number 4 Region: 416-620
Classification Level Classification E-value
Superfamily Fibronectin type III 4.4e-27
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 312-448
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000869
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8ALS1
Sequence length 1496
Comment (tr|A0A0F8ALS1|A0A0F8ALS1_LARCR) Receptor-type tyrosine-protein phosphatase U {ECO:0000313|EMBL:KKF22738.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_06743 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MAPGSGEDRAGGRPRAFPSRPRAGRDAPPLRKCAGERSHEWILPHLAAVPDPPTGCTFDE
DSDPGLCEYRQGQDDDFDWQLIRTYNWPHPTPDLLRGSFMMVNSSQHFGGQRAQLLLLPL
SENDTHCIQFSYFLYSRDGHSPGDLQVYIRVNGGPKGSAVWNISGSQGRQWHQVELAVST
FWPSEYQVIFEATISEERQGYIALDDIVLLNYPCYKVPHFSRLGDVEVNAGQNASFQCVA
TGKVSEIEPFLLERRNGMLLDTPLLSRLSHKRLMATFQVEAQRGEQDLYRCITLSSRGAA
VSNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREIQYRASQSMWTE
THGVGSLTYKVWHLEPDTEYRISVLLTRPGDGGTGAPGPPLISRTKCAEPMRALRGLTAS
EIQPRQLVLQWEPLGYNLTRCHTYTLSLCYRYSMPTGGSGGNNATVRECLSVERNTSHFT
LRDLPPFRSVHVRLALANPEGKKESREVTFQTEEDIPGGIAPESLTFTPLDDMIFLKWEE
PVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGTTYLVSVRA
RTTKGFGQTALTEITTNISAPVFDYEDIPSPLSESESTITVLLRPALARGAPVSAYQVVV
VEEDGSRQVKRRELGTSDCFPTPNSHNEAQARGAPHYYTAELAPSSLPEATPFTVGDNHT
YNGYWNSPLDPTKNYLIYFQATSNFRGETRINCIRIARKAACKDSKRALEVSQHAEDMGL
ILGACAGGLVVLILLLGAIVVIVKKGRDFYSYPYYPKKVAINKAAMSYRQEKSRKLSSLD
CSMTEQSTLKQDERMAHSFMDAHGCNARNEQRSSVNESSSLLGGSPHRHCRRKSSPYHTG
QLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFDGWDVTKKKDKTKGRHDSLLSHDRHR
VKLHSLLADPSSDYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVWQENCFSIVMITK
LVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVCQFHFT
SWPEHGVPYHATGLLAFLRRVKASTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAECEG
VVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAIPVNEFALTYKEMLKVDS
QSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDRSLAFLVTTEGES
SNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLNQLNQSNSAWPCL
QYWPEPGLQQFGPMTVELLSRTADDDVIIRLFRVQNITRDPEEADPTEQDNDSLCPKKLQ
EGQLVVRHFQFLRWSPYRDVPDSKKAFLSLLAQVHNWQRECGEGRTIVHCLNGGGRSGTF
CACTMILEMIRHHSVVDVFFAAKTLRNSKPNMVETMEQYRFCYDLAQEYLDCLEIR
Download sequence
Identical sequences A0A0F8ALS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]