SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8AP39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AP39
Domain Number 1 Region: 277-480
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-56
Family DBL homology domain (DH-domain) 0.0000000593
Further Details:      
 
Domain Number 2 Region: 481-616
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-37
Family Pleckstrin-homology domain (PH domain) 0.0000081
Further Details:      
 
Domain Number 3 Region: 199-285
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-28
Family Regulator of G-protein signaling, RGS 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AP39
Sequence length 972
Comment (tr|A0A0F8AP39|A0A0F8AP39_LARCR) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:KKF28548.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_03617 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
LYFVSSLCLSRTPSILNKDPTDKKPKNEKSSVSLKHEFDPTDGAAMRAGVQTGDRIIKPE
NKPAQSQKADNMQKMLLKEQQDLQSKEEESSRDSGPSIHLREQANAIATDGTWTNNNSMH
SSPLPESTGKRETPCQSPDISRRDGLNFYSSPEADDHPDMDSSAQSTVGSPPHPLNPQII
GAEDDYFDSQQEQINGECSSFQSLDLLKSRPAHLAVFLHHVVSQFDPAPLLCYLYADMHK
QTSSKESRRFFMEFHSLFMDRTANLKVPLPESIAGEMELFYTERAHLRTLKVLDCVFYQR
LNRDSILPPEDIKHIFINLEEIIQLHVSIMEQMTAIRKRSETSVIGQIADDLLAWFSGEG
EEKIKKAVGTFCSNQPSALELIKSKKKKDQRFTLFMQEAESNRLCRRLQLKDIIPVEMQR
VTKYPLLLDNIAKYTEDGEEREKVKKAGECCKKILNHVNQAVKEAENKLRLEEYQRRLDL
SSLKTSENPMILELKNLDLTKRKMVHEGPLSWKVNKDKTIELYTILLEDILVLLQKQDER
LILKFHGKNLASAADTKHIFSPIIKLNTVLVRPVATHNKSFFVLSMSENGAQIYELMAQT
VSDQRTWQCLITQCADAMKAKPHNRDAPPAQSDAEGDAIEIIKHGMPKTSKDPNRTSSGS
IQSSDKDATSSPDVQAPASMNPFDGMKSEDEEDELAVGDRQEEEELAVGDRQEEEELAVG
DRQEEEELAVGDRQEEEDDEEVDEAELEAFLDGQLADRMPFLQEGSRQGIALENQDHDTF
SLPTSKGEEALRTLAMLKQAVFTHILSREAEEETEENKPSSGPEGPSATCDESGASTSSQ
KDSPHLTSGLPEATERNGGFMVLDFGGGFEESSTDDDGGVAGDVGIDMRKLLSSSSQTGG
SCGPNLNRQLMTHLRLLQADLQYLKEVEMKYNELRQTHSDLATDLDDNNGAFHFSQPLGT
IHINVLCTVSES
Download sequence
Identical sequences A0A0F8AP39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]