SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8AXP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AXP2
Domain Number 1 Region: 121-181,280-363
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-29
Family Regulator of G-protein signaling, RGS 0.0092
Further Details:      
 
Domain Number 2 Region: 361-496
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.42e-27
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AXP2
Sequence length 651
Comment (tr|A0A0F8AXP2|A0A0F8AXP2_LARCR) A-kinase anchor protein 10, mitochondrial {ECO:0000313|EMBL:KKF15828.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_08172 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSFFKRKGEDVNGAKTASERGRDNPAEEEEEEEEEESAKSKEPERATDAKVNRAPASPHS
PSLGLRNHNAIQDAAGPSHVAINAISANMDSFARGRTAILKKQPSHMEAAHFGDLGHSSV
NYQPQETRSRLSKTVDHVLRDNVAIPHYMHFTELRGADHLVRFWLEAESFRSTSWSRVRA
HSLNSVKHSSLAEPVPSSQDGSDLRELAQYTRNALARDCSSDGPTVQSEWRDFSNTEADL
RPGTPQADTPSKQASSRTGTPYKGQSNSTLRDLSDKLMKSIEKDAVTIFTKYISPDAVRP
IPITEQIRNDIVAKICGEDGMVDPNCFVIAQSVVVTILDQQHFSEFLRSHHFCKYQIEVL
TSGSVFLADILFCESALFYFSEYMEKEEAMNVLQFWLAADNFQNQLAAKKGQYDGQEAQN
DAMILYDKYFSLQATNPLGFGDSVRMEIESNICREGGPLPDCFTTPLRQAWTTMEKVYMP
GFLSSNLYYKYLSDLINSVRADEFVNVSTPGQGGPADNERSSSNASEVSQTQQGSRKAVI
KILKNFDEAITVDVASLDPESLYQRPYAGKMTFGKVNEMGQFIREAEPEPDVKKSKGSMF
SQAMKKWVQGNSDEAQEEMAWQIAKMIVNDVVHQSNHDSPGKATKVQDLAR
Download sequence
Identical sequences A0A0F8AXP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]