SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8BFS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8BFS8
Domain Number 1 Region: 67-115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000183
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8BFS8
Sequence length 255
Comment (tr|A0A0F8BFS8|A0A0F8BFS8_LARCR) RPE-spondin {ECO:0000313|EMBL:KKF33992.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_05843 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MGQVSSFLISPCQSGCRETGLCCTGRDPSCFSRGWRSDRSYGTCYCDQACVSTLDCCYDY
ETACPAVSCVVSEWTEWSGCAEACRATIRRRSRTILREPLNAGKPCPHLEEHAGCAEYRS
QQGHCHNSLVPALIITGGYGNARKKRDIPDGSDIIGYCVQFQLTSLTKGCQQSTDPHTQW
MQYLTEGHRVCVECQPPALAAGQMHCSGDGEENAADRRQSLQWQAVGNPRCRGVWRRVGR
LEACSCPTAHSFLFI
Download sequence
Identical sequences A0A0F8BFS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]