SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K126 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K126
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.67e-21
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000513
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 5-71,422-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000816
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  A0A0G2K126
Domain Number - Region: 142-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000575
Family Intermediate filament protein, coiled coil region 0.0078
Further Details:      
 
Domain Number - Region: 223-336
Classification Level Classification E-value
Superfamily Prefoldin 0.0011
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K126
Sequence length 486
Comment (tr|A0A0G2K126|A0A0G2K126_RAT) Keratin 86 {ECO:0000313|Ensembl:ENSRNOP00000071675} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Krt86 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MTCGSYCGGRAFSCASACGPRPGRCCITAAPYRGISCYRGLSGGFGSHSVCGAFRSGSCG
RSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSRFAAF
IDKVRFLEQQNKLLETKWQFFQNRKCCESNVEPLFEGYIETLRREAECVEADSGRLAAEL
NHAQEAMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANTEALTQEIDFLR
RLYEEETRILHAHISDTSVIVKMDNSRDLNMDCVIAEIKAQYDDIASRSRAEAESWYRTK
CEEIKATVIRHGETLRRTREEINELNRIIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAA
LTDARCKLAELEAALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCVSGTAPAVNTRVCSAPCSGNVVVGTPNACGPCAGAGACS
GGCKKC
Download sequence
Identical sequences A0A0G2K126
XP_017450523.1.100692 ENSRNOP00000039183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]