SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K1E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K1E2
Domain Number 1 Region: 94-538
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-96
Family Integrin alpha N-terminal domain 0.000000000418
Further Details:      
 
Domain Number 2 Region: 838-1052
Classification Level Classification E-value
Superfamily Integrin domains 9.68e-51
Family Integrin domains 0.0000582
Further Details:      
 
Domain Number 3 Region: 540-696
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-44
Family Integrin domains 0.00000975
Further Details:      
 
Domain Number 4 Region: 697-830
Classification Level Classification E-value
Superfamily Integrin domains 3.5e-32
Family Integrin domains 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K1E2
Sequence length 1099
Comment (tr|A0A0G2K1E2|A0A0G2K1E2_RAT) Integrin subunit alpha 5 {ECO:0000313|Ensembl:ENSRNOP00000071805} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_50755 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MPPRQPTRRPGGGPSRELGKLLPALSHSPLGGLGSGSGSVAPGQGRTGAMGSWTPRSPRS
PLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPGSLFGFSVEFYR
PGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCSTIQFDSKGSRILESSLYSE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCYLSTENFTRILEYAP
CRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPQYLI
NPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTVLNGSDI
HSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQH
PEGIEPTPSLTLTGQDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGG
PGGLNTKPSQVLQPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKALVYRGRP
IISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVPNSIGFEVELQLDWQ
KQKGGVRRALFLASKQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLAVYGEKKHVYLGDK
NALNLTFLAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLSCDYFAVNQSRQLVC
DLGNPMKAGTSIWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQSNMVSFPLSVEAQAQ
VSLNGVSKPEAVIFPVSDWNPQDQPQKEGDLGPAVHHVYELINQGPSSISQGVLEISCPQ
ALEGQQLLYVTKVTGLNNCTSNYTPNSQGLELDPEVSPHHLQRREAPGRSSTTSGTQVLK
CPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQQEYQPFSLQCEALYEALKMPYQI
LPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLLIYVLYKLGFFKRSL
PYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences A0A0G2K1E2
10116.ENSRNOP00000052152 ENSRNOP00000052152 NP_001101588.1.100692 NP_001101588.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]