SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K4Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K4Z9
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-39
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K4Z9
Sequence length 503
Comment (tr|A0A0G2K4Z9|A0A0G2K4Z9_RAT) Zinc finger and SCAN domain-containing 12 {ECO:0000313|Ensembl:ENSRNOP00000073238} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_23053 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MMASTNDTKICKNQDGLLEIKMEEECKYTTRQVRNLQKNTYNRDVFRKYFRQFCYQETSG
PREALSRLRELCHQWLRPDMHSKEQILELLVLEQFLTILPEELQAWVQEQNPESVEEVVT
VLEDLERELDELGYRTSVQIEKQEMLLRETKPLAAEQKPSVSLQFVKAKPGCELADGEAQ
EEQVSGIETGNESRNVTLKQGLWEGMEAEQNPSSRLAKDTLKCEETRDPREESSGISRED
SQPLRNENVVNLTENSNHAELQNICPGRKVHGCDECGKTFSQHSRLIEHRRIHTGDRPYR
CEECGKTFRWRTVLIRHKVVHTGEKPYKCNECGRAFGQWSALNQHQRLHSGEKHYHCNEC
GKAFCQKAGLFHHLKSHRRNRPYQCLQCNKSFNRRSTLSQHQGVHTGTKPYECSDCGRAF
VYNSSLATHQETHHKEKLFTQSGPSQQRKNHTSEKSYKCSICGKTFVQKTSLIEHEQIHT
EERPYKCAEGGKAFIQVSDLTEH
Download sequence
Identical sequences A0A0G2K4Z9
XP_002728531.1.100692 XP_017443229.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]