SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3WJ11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3WJ11
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.19e-30
Family SMI1/KNR4-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3WJ11
Sequence length 141
Comment (tr|A0A0G3WJ11|A0A0G3WJ11_9BACT) Putative Antitoxin YobK {ECO:0000313|EMBL:AKL97872.1} KW=Complete proteome; Reference proteome OX=1408281 OS=Endomicrobium proavitum. GN=Epro_0493 OC=Endomicrobiaceae; Endomicrobium.
Sequence
MYSFQKLEDLISKYSKVKSFTGGVNGKKIAYIEKELNVILPEQYKWFLAKYGYGGVLGIE
ILGAALNNTYPVIEYTQNCREYNLNKQWIVIENCDEYYYCLSCEDGKVRDWDLRKKTYYE
YPNFVDFLYETIMDSAENWQE
Download sequence
Identical sequences A0A0G3WJ11
WP_052570290.1.95072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]