SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3Z7N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3Z7N9
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.08e-56
Family Acetylcholinesterase-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3Z7N9
Sequence length 144
Comment (tr|A0A0G3Z7N9|A0A0G3Z7N9_COLHO) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} OX=115425 OS=Cochliomyia hominivorax (Primary screw-worm) (Lucilia hominivorax). GN=alphaE7 OC=Oestroidea; Calliphoridae; Chrysomyinae; Cochliomyia.
Sequence
LTPETKRPVLVYIHGGDFVIGENHREYYGPNYFIKKDVVLITIQYRLGVLGFLSLNSEEL
NVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGGASAHYMMLTEQTRGLFHRG
ILMSGNAVCPWAISQNQHRAYAIA
Download sequence
Identical sequences A0A0G3Z7N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]