SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4D1B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4D1B4
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.35e-22
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4D1B4
Sequence length 216
Comment (tr|A0A0G4D1B4|A0A0G4D1B4_BACTO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:BAR84452.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_03608 OC=Bacillus cereus group.
Sequence
MDYELLKERIEIITSRIKYIGGEVQEVCIDEPSSLEQIIQVEEKLGIKLPNSFKKVLLEF
SGNFSLRWFSPDDVELPNELTDIFCGTPHWSLESLSEFEKERKDLVDEFFSNLDDEYDVV
WHNKLAFCEVGNGDYLAFDMKDDIDAPIIYLSHDDGEGHGYKIANNFIEFIENWSRVAFV
GCEDWQWLPFTTSFESGINPDDEPAKKFRNCLGLNI
Download sequence
Identical sequences A0A0G4D1B4 J8I555
WP_000384353.1.14174 WP_000384353.1.93683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]