SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4GSY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4GSY9
Domain Number 1 Region: 476-580
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000000605
Family Atu1531-like 0.041
Further Details:      
 
Domain Number 2 Region: 300-364
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000397
Family PA3566-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4GSY9
Sequence length 636
Comment (tr|A0A0G4GSY9|A0A0G4GSY9_VITBC) Uncharacterized protein {ECO:0000313|EMBL:CEM33832.1} KW=Complete proteome; Reference proteome OX=1169540 OS=Vitrella brassicaformis (strain CCMP3155). GN=Vbra_23162 OC=Eukaryota; Alveolata; Chromerida; Vitrella.
Sequence
MKWCVPSRLPRSPQPVSPLQLEGILAFQNVPQQDVLKMVGLCAFGAMLTMAIRTTLSARA
RAAPRSFLRSVIVAYSVATPIFALVFGLYGSSKLLLVLAALHNLCEWGIIWHLVLETSAI
TPTFYGSVLWIWTIVSIVAVAPTLELAVAIEQPFGLWCDFLLFFLMLKRLSEVQEGDVYL
RRLFLMGLVASIVHFGQIFTLILGGLGVPGTTLWLLLLVFSPLVTFGLYSEFALRWDEAP
VPPYRQHHMNVFEAFFIFILSLVLSTSVIFGPPLLFRCPAVAAQASSQCSQSVSGFTVFK
AASPNVRNALGDFLREVAHSTLAEPGNEIYEVFEVERGKGGSDEWDFAVVERYWSLEALQ
THLKRVEPLFNQEYYHGLAADMVEFGPWRRAEWCQPSYPPQLRHLAFRFAIDNDVDAIWS
VVRNWRSLEALQTHLKRVEPLFNQEYYHGLAADMIEFGPWRRAEWCQPSYPPQLRHLAFR
FTIDNDVDAIWSVVRNWSDVTMVLGAVSAELDENDERLRVVKFRNGLELEERLSVLDHSQ
KRLVYEHSNQLGLRFYRGSINLESNGTGGTLVSYVIDIGLEGDAQGRSDAMKASFQGQNI
PYLQERFSHAGLSSNALLNEGTPVIYDASVVEKVEL
Download sequence
Identical sequences A0A0G4GSY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]